PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000161239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 1105aa    MW: 123558 Da    PI: 7.9112
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000161239genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.81.2e-0566122157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ ++ ++++F  +  +s++e +eL +  g+t +qV+ +F  +R + +k
  MDP0000161239  66 KRPRDLLNPKAIKYMQSVFSIKDSISKKESRELNALFGITVTQVRDFFNSQRSRVRK 122
                    799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.89663123IPR001356Homeobox domain
SuperFamilySSF466895.99E-665126IPR009057Homeodomain-like
SMARTSM003890.001265127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-566131IPR009057Homeodomain-like
CDDcd000867.77E-466122No hitNo description
Gene3DG3DSA:1.20.930.102.3E-6222311IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.07E-5225311IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1105 aa     Download sequence    Send to blast
MEDPSAEMEI GTSPESFGKF LDSQRELFHS QIDQLQRIVG TQCKLTGVNP LSQEMAAGAL  60
SIKIGKRPRD LLNPKAIKYM QSVFSIKDSI SKKESRELNA LFGITVTQVR DFFNSQRSRV  120
RKLVQLSREK ALKSGEHKDL QDGVSTSPDS LTPSDPVPLN SVGPANVEDA PSCSTQDDAP  180
SGLDDLDKCF VEDIFNLMRK EETFSGQVKL MEWILRIQNS SVLCWFLTKG GVMILVTWLS  240
QAAVEEQTNV LLVILKVLCH LPLHKALPLH MSAVLQSVNR LRFYRTADIS NRARVLLSRW  300
SKLLAKNQAL EKPNGIKTSS DSGQDIDEVM GDESWKSNMD ISEDFLGTPF ESAENFRKVN  360
ASEPLKLLTA SSDESNKKNI LGVSSSRILN IEFRERRKVQ LVEQPGQKSA GRSVQATRTT  420
PVSQARPMSA DDIQKAKMRA QFMQSKYGKS GSSHENKELK TEGVKKLKTS QASILPVVPK  480
VPIRSNIEEP NIPATYPLKE RETPNRPETT IAPKRSMDLK EPILEKCRRI QIPWKMPPGN  540
VTVQASQLCG RLYLPHRENE WRMSFLPCDS SWVYWCPCGC SLPDKSGLAQ FSFWLVDGFF  600
GYFFMPFPFL SAEIKLDPSW SVGGGENGKE NEVQRNRNRR EKEIIYRTVQ ETPSNPKEPW  660
DIEMDYDDSL TPEIPIEQPP DVADSTETQA FPREYNPETM VVPSQGANSV ASLPPALSQI  720
NKASAAEPDL ELLAVLLKNP ELVFALTSGQ AANLSSEDTV KLLDMIKSGG AGVAGSVNGL  780
GRKMEERVEV SLPSPTPSSN PGTESPSMKQ VASSEWWLIF PWTEINLPTL RDVIVSGIPS  840
QRQAKRFMAF PHGNALLSGW KGDAGRNAFP QQMPQVSSAH RSIPPERLST PQPAVPSYSP  900
DYYPMQTPAS EMTSITKNTH FHNLSNMTVP SVWGESTSNV ERAPLSTSYN LAEMQQPLFS  960
NMARQQRQPQ PLQQQQQRFS TPTYSPNPPM GKAVPPSESW RARQDLTSNY HYLENQNQYN  1020
ASHGGHLQPH LSGPWEGYER VGSNQDFHSW SPDDDDSPSR NPGYMYGREP RTNPGRDYTS  1080
RGRNPAGYRG HTRQRGNRWP NRGGD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.227590.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199703.10.0hypothetical protein PRUPE_ppa000815mg
SwissprotQ387961e-171LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLM5VIN40.0M5VIN4_PRUPE; Uncharacterized protein
STRINGVIT_07s0104g01580.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-166HB-other family protein